PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 211aa    MW: 22583 Da    PI: 8.8299
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32677.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.81.5e-401676262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++lkcprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+s
  KHN32677.1 16 EQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGSRKNTKRS 76
                57899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-251165IPR003851Zinc finger, Dof-type
PfamPF027011.5E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5622074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MQDPTLFQPM KPHFPEQEQL KCPRCDSTNT KFCYYNNYNL SQPRHFCKNC RRYWTKGGAL  60
RNIPVGGGSR KNTKRSSSSN NNTKRASPSP PVSSAPAPEP DPTRIGPTPV VGGGSFSSLL  120
ASSGHLGLGN LLEGLNSSGS NLKTVQMEEF GENVSSGPVA DPGSGRNPGL EMQSNGNAEN  180
FLSLQNGDSS CWNGTSGWSH LAIFTPGSSF Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572520.0DQ857252.1 Glycine max Dof1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546653.11e-153PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotO821555e-45DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A0B2RLF21e-154A0A0B2RLF2_GLYSO; Dof zinc finger protein DOF1.7
STRINGGLYMA15G02620.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61813351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-35DOF zinc finger protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]